HPA018205

CALHM3 antibody from Sigma-Aldrich
bA225H22.7, FAM26A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018205
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018205, RRID:AB_2069267
Product name
Anti-CALHM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018205
Antibody type
Polyclonal
Antigen
Calcium homeostasis modulator protein 3 (Protein FAM26A)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCAFSSSVDPEKFLDFANMTPSQVQLFLAKVPCKE
DELVRDSPARKAVSRY
Storage
-20C
Provider Type Product Number
- No reagents -