HPA018205

CALHM3 antibody from Atlas Antibodies
bA225H22.7, FAM26A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018205
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018205, RRID:AB_1234273
Product name
Anti-CALHM3
Provider product page
Atlas Antibodies - HPA018205
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VCAFSSSVDPEKFLDFANMTPSQVQLFLAKVPCKE
DELVRDSPARKAVSRY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -