Antibody data

Product number
H00010513-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010513-M09, RRID:AB_1137090
Product name
APPBP2 monoclonal antibody (M09), clone 4C2
Provider product page
Abnova Corporation - H00010513-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant APPBP2.
Antigen sequence
NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGL
IKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTD
ALEDVSTSPQSTEEVVQSFLISQNVEGPSC
Isotype
IgG
Antibody clone number
4C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -