HPA018317

CALHM1 antibody from Sigma-Aldrich
FAM26C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018317
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018317, RRID:AB_1848392
Product name
Anti-CALHM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018317
Antibody type
Polyclonal
Antigen
Calcium homeostasis modulator protein 1 (Protein FAM26C)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLAT
APASAAAPTTPDGAEEEREKLRGITDQGTMNRLLT
SWHKCKPPLRLGQEEPPLMGNGW
Storage
-20C
Provider Type Product Number
- No reagents -