Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010199-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010199-M02, RRID:AB_565974
- Product name
- MPHOSPH10 monoclonal antibody (M02), clone 1B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MPHOSPH10.
- Antigen sequence
NVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKK
PWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVI
TEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAY
EYKKR- Isotype
- IgG
- Antibody clone number
- 1B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MPHOSPH10 monoclonal antibody (M02), clone 1B10 Western Blot analysis of MPHOSPH10 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MPHOSPH10 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MPHOSPH10 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol