Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005076-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005076-M01, RRID:AB_509365
- Product name
- PAX2 monoclonal antibody (M01), clone 3C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PAX2.
- Antigen sequence
PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHL
RADTFTQQQLEALDRVFERPSYPDVFQASEHIKSE
QGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSG
TQTYP- Isotype
- IgG
- Antibody clone number
- 3C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cerebral organoids model human brain development and microcephaly.
Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture.
Ontogeny-recapitulating generation and tissue integration of ES cell-derived Purkinje cells.
Lancaster MA, Renner M, Martin CA, Wenzel D, Bicknell LS, Hurles ME, Homfray T, Penninger JM, Jackson AP, Knoblich JA
Nature 2013 Sep 19;501(7467):373-9
Nature 2013 Sep 19;501(7467):373-9
Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture.
Koehler KR, Mikosz AM, Molosh AI, Patel D, Hashino E
Nature 2013 Aug 8;500(7461):217-21
Nature 2013 Aug 8;500(7461):217-21
Ontogeny-recapitulating generation and tissue integration of ES cell-derived Purkinje cells.
Muguruma K, Nishiyama A, Ono Y, Miyawaki H, Mizuhara E, Hori S, Kakizuka A, Obata K, Yanagawa Y, Hirano T, Sasai Y
Nature neuroscience 2010 Oct;13(10):1171-80
Nature neuroscience 2010 Oct;13(10):1171-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol