Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005076-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005076-M02, RRID:AB_913770
- Product name
- PAX2 monoclonal antibody (M02), clone 2E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PAX2.
- Antigen sequence
PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHL
RADTFTQQQLEALDRVFERPSYPDVFQASEHIKSE
QGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSG
TQTYP- Isotype
- IgG
- Antibody clone number
- 2E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The transcription factor PAX2 regulates ADAM10 expression in renal cell carcinoma.
c-Jun is essential for the induction of Il-1β gene expression in in vitro activated Bergmann glial cells.
Doberstein K, Pfeilschifter J, Gutwein P
Carcinogenesis 2011 Nov;32(11):1713-23
Carcinogenesis 2011 Nov;32(11):1713-23
c-Jun is essential for the induction of Il-1β gene expression in in vitro activated Bergmann glial cells.
Albanito L, Reddy CE, Musti AM
Glia 2011 Dec;59(12):1879-90
Glia 2011 Dec;59(12):1879-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PAX2 monoclonal antibody (M02), clone 2E4 Western Blot analysis of PAX2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol