Antibody data

Product number
H00051533-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051533-M11, RRID:AB_1204789
Product name
PHF7 monoclonal antibody (M11), clone 1A7
Provider product page
Abnova Corporation - H00051533-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PHF7.
Antigen sequence
GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNS
KKWECEECSPAAATDYIPENSGDIPCCSSTFHPEE
HFCRDNTLEENPGLSWTDWPEPSLLEKPES
Isotype
IgG
Antibody clone number
1A7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -