HPA012158

B3GNT6 antibody from Sigma-Aldrich
B3Gn-T6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012158
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012158, RRID:AB_10603677
Product name
Anti-B3GNT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012158
Antibody type
Polyclonal
Antigen
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PREERSPQEETPEGPTDAPAADEPPSELVPGPPCV
ANASANATADFEQLPARIQDFLRYRHCRHFPLLWD
APAK
Storage
-20C
Provider Type Product Number
- No reagents -