Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028918 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028918, RRID:AB_10603022
- Product name
- Anti-MYO7A
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WAVLTVQAYARGMIARRLHQRLRAEYLWRLEAEKM
RLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE
DAERELKEKEAARRKKELLEQMERARHEPVNHSDM
VDKMFGFLGTSGGLPGQEGQAPSGFE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
A role for mutations in
AK9
and other genes affecting ependymal cells in idiopathic normal pressure hydrocephalus
Repurposing the lineage-determining transcription factor Atoh1 without redistributing its genomic binding sites
Assessment of cochlear toxicity in response to chronic 3,3′-iminodipropionitrile in mice reveals early and reversible functional loss that precedes overt histopathology
Yang H, Lee S, Berry B, Yang D, Zheng S, Carroll R, Park P, Johnson M
Proceedings of the National Academy of Sciences 2023;120(51)
Proceedings of the National Academy of Sciences 2023;120(51)
Repurposing the lineage-determining transcription factor Atoh1 without redistributing its genomic binding sites
Costa A, Powell L, Malaguti M, Soufi A, Lowell S, Jarman A
Frontiers in Cell and Developmental Biology 2022;10
Frontiers in Cell and Developmental Biology 2022;10
Assessment of cochlear toxicity in response to chronic 3,3′-iminodipropionitrile in mice reveals early and reversible functional loss that precedes overt histopathology
Greguske E, Llorens J, Pyott S
Archives of Toxicology 2021;95(3):1003-1021
Archives of Toxicology 2021;95(3):1003-1021
No comments: Submit comment
No validations: Submit validation data