HPA028403

CCDC28B antibody from MilliporeSigma / Merck KGaA
MGC1203, RP4-622L5.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028403
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028403, RRID:AB_10600192
Product name
Anti-CCDC28B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028403
Antibody type
Polyclonal
Antigen
coiled-coil domain containing 28B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGE
EEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLS
Storage
-20C
Provider Type Product Number
- No reagents -