H00008668-M01

EIF3I antibody from Abnova Corporation
eIF3-beta, eIF3-p36, eIF3i, EIF3S2, TRIP-1

Antibody data

Product number
H00008668-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008668-M01, RRID:AB_1204308
Product name
EIF3S2 monoclonal antibody (M01), clone 3B10
Provider product page
Abnova Corporation - H00008668-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EIF3S2.
Antigen sequence
FRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTST
RIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHP
DGKSYSSGGEDGYVRIHYFDPQYFEFEFEA
Isotype
IgG
Antibody clone number
3B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -