Antibody data

Product number
H00079760-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079760-M09, RRID:AB_1137227
Product name
GEMIN7 monoclonal antibody (M09), clone 4H6
Provider product page
Abnova Corporation - H00079760-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GEMIN7.
Antigen sequence
ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQ
VSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIG
VQAEALLRCSDIISYTFKP
Isotype
IgG
Antibody clone number
4H6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -