Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051773-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051773-M05, RRID:AB_581696
- Product name
- HBXAP monoclonal antibody (M05), clone 3E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HBXAP.
- Antigen sequence
IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPG
KAIENLIGKPTEKSQTPKDNSTASASLASNGTSGG
QEAGAPEEEEDELLRVTDLVDYVCNSEQL- Isotype
- IgG
- Antibody clone number
- 3E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HBxAPα/Rsf-1-mediated HBx-hBubR1 interactions regulate the mitotic spindle checkpoint and chromosome instability.
Chae S, Ji JH, Kwon SH, Lee HS, Lim JM, Kang D, Lee CW, Cho H
Carcinogenesis 2013 Jul;34(7):1680-8
Carcinogenesis 2013 Jul;34(7):1680-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HBXAP is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RSF1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol