Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008411-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008411-M03, RRID:AB_1112249
- Product name
- EEA1 monoclonal antibody (M03), clone 2G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EEA1.
- Antigen sequence
KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALN
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIF
CAECSAKNALTPSSKKPVRVCDACFNDLQG- Isotype
- IgG
- Antibody clone number
- 2G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Flipping the Switch on Clathrin-Mediated Endocytosis using Thermally Responsive Protein Microdomains.
Pastuszka MK, Okamoto CT, Hamm-Alvarez SF, MacKay JA
Advanced functional materials 2014 Sep 10;24(34):5340-5347
Advanced functional materials 2014 Sep 10;24(34):5340-5347
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEA1 monoclonal antibody (M03), clone 2G2. Western Blot analysis of EEA1 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EEA1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EEA1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol