Antibody data

Product number
H00008411-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008411-M02A, RRID:AB_1204299
Product name
EEA1 monoclonal antibody (M02A), clone 1D4
Provider product page
Abnova Corporation - H00008411-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EEA1.
Antigen sequence
KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALN
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIF
CAECSAKNALTPSSKKPVRVCDACFNDLQG
Isotype
IgG
Antibody clone number
1D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -