Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008411-M02A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008411-M02A, RRID:AB_1204299
- Product name
- EEA1 monoclonal antibody (M02A), clone 1D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EEA1.
- Antigen sequence
KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALN
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIF
CAECSAKNALTPSSKKPVRVCDACFNDLQG- Isotype
- IgG
- Antibody clone number
- 1D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references AmotL2 disrupts apical-basal cell polarity and promotes tumour invasion.
Mojallal M, Zheng Y, Hultin S, Audebert S, van Harn T, Johnsson P, Lenander C, Fritz N, Mieth C, Corcoran M, Lembo F, Hallström M, Hartman J, Mazure NM, Weide T, Grandér D, Borg JP, Uhlén P, Holmgren L
Nature communications 2014 Aug 1;5:4557
Nature communications 2014 Aug 1;5:4557
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEA1 monoclonal antibody (M02A), clone 1D4. Western Blot analysis of EEA1 expression in Raw 264.7 ( Cat # L024V1 ).