HPA005740

SDSL antibody from Sigma-Aldrich
cSDH, SDS-RS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005740
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005740, RRID:AB_10601486
Product name
Anti-SDSL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005740
Antibody type
Polyclonal
Antigen
serine dehydratase-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHLVCSSGGNAGIAAAYAARKLGIPATIVLPESTS
LQVVQRLQGEGAEVQLTGKVWDEANLRAQELAKRD
GWENVPPFDHPLIWKGHASLVQELKAVLRT
Storage
-20C
Provider Type Product Number
- No reagents -