Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064211-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064211-M05, RRID:AB_804978
- Product name
- LHX5 monoclonal antibody (M05), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LHX5.
- Antigen sequence
CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNE
NEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKP
TRHIREQLAQETGLNMRVIQVWFQNRRSKE- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LHX5 monoclonal antibody (M05), clone 2B11. Western Blot analysis of LHX5 expression in 293 ( Cat # L026V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LHX5 monoclonal antibody (M05), clone 2B11. Western Blot analysis of LHX5 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LHX5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol