H00009212-M04
antibody from Abnova Corporation
Targeting: AURKB
Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009212-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009212-M04, RRID:AB_534786
- Product name
- AURKB monoclonal antibody (M04), clone 6G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AURKB.
- Antigen sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVT
PSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTR
HFTIDDFEIGRPLGKGKFGN- Isotype
- IgG
- Antibody clone number
- 6G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody (M04), clone 6G8.Lane 1: AURKB transfected lysate(39.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AURKB is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol