H00009212-M06

AURKB antibody from Abnova Corporation
Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
No application information provided.

Antibody data

Product number
H00009212-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009212-M06, RRID:AB_1203986
Product name
AURKB monoclonal antibody (M06), clone 3F2
Provider product page
Abnova Corporation - H00009212-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant AURKB.
Antigen sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVT
PSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTR
HFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVAL
KVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRL
YNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQ
RTATIMEELADALMYCHGKKVIHRDIKPENLLLGL
KGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMI
EGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNE
TYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSER
LPLAQVSAHPWVRANSRRVLPPSALQSVA
Isotype
IgG
Antibody clone number
3F2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -