H00092105-B01

INTS4 antibody from Abnova Corporation
INT4, MGC16733, MST093

Antibody data

Product number
H00092105-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092105-B01, RRID:AB_1138459
Product name
INT4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00092105-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human INT4 protein.
Antigen sequence
MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSK
SAALHIDLCKATSPADALQYLLQFARKPVEAESVE
GVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGF
SPDCIMDDAINILQNEKSHQVLAQLLDTLLAIGTK
LPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLG
NLGSLEKSVTKDAEGLAARDVQKIIGDYFSDQDPR
VRTAAIKAMLQLHERGLKLHQTIYNQACKLLSDDY
EQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLV
DDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVSSH
FLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSS
GRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLED
EMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMF
NDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAV
LEDSSRDIREALHELLCCTNVSTKEGIHLALVELL
KNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPEL
LSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPT
MPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLV
SSAVSPSIIPQEDPSQQFLQQSLERVYSLQHLDPQ
GAQELLEFTIRDLQRLGELQSELAGVADFSATYLR
CQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQI
MEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLI
VTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLP
HLQDSFVDKLLDLMPRLMTSKPAEVVKILQTMLRQ
SAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSG
LVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMI
HPKPADFRNPGPGRHRLITQVYLSHTAWTEACQVE
VRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGT
IPFSKPVKVYIMPKPARR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -