H00007069-M01

THRSP antibody from Abnova Corporation
Lpgp, LPGP1, S14, SPOT14, THRP

Antibody data

Product number
H00007069-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007069-M01, RRID:AB_1580956
Product name
THRSP monoclonal antibody (M01), clone 2F8
Provider product page
Abnova Corporation - H00007069-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant THRSP.
Antigen sequence
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPS
LLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV
DHGLLPREEWQAKV
Isotype
IgG
Antibody clone number
2F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -