Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183331 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYG
SNVPN MHNGMNQQAY- Vial size
- 0.1 mg
Submitted references Host cell interactome of HIV-1 Rev includes RNA helicases involved in multiple facets of virus production.
Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation.
Naji S, Ambrus G, Cimermančič P, Reyes JR, Johnson JR, Filbrandt R, Huber MD, Vesely P, Krogan NJ, Yates JR 3rd, Saphire AC, Gerace L
Molecular & cellular proteomics : MCP 2012 Apr;11(4):M111.015313
Molecular & cellular proteomics : MCP 2012 Apr;11(4):M111.015313
Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation.
Guil S, Gattoni R, Carrascal M, Abián J, Stévenin J, Bach-Elias M
Molecular and cellular biology 2003 Apr;23(8):2927-41
Molecular and cellular biology 2003 Apr;23(8):2927-41
No comments: Submit comment
No validations: Submit validation data