HPA020043

DDX5 antibody from Sigma-Aldrich
G17P1, HLR1, p68
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020043
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020043, RRID:AB_1847572
Product name
Anti-DDX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020043
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEI
TVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEP
TAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPA
IVHINHQPFLERGDGPICLVLAPTRELAQQVQQV
Storage
-20C
Provider Type Product Number
- No reagents -