Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309676 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Protein Phosphatase 1, Regulatory Subunit 13 Like (PPP1R13L) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVAL
PPTHK KQYQQIISRL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular docking analysis of the protein-protein interaction between RelA-associated inhibitor and tumor suppressor protein p53 and its inhibitory effect on p53 action.
Tomoda K, Takahashi N, Hibi Y, Asamitsu K, Ishida H, Kondo T, Fujii Y, Okamoto T
Cancer science 2008 Mar;99(3):615-22
Cancer science 2008 Mar;99(3):615-22
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry