H00026056-B01P

RAB11FIP5 antibody from Abnova Corporation
GAF1, KIAA0857, pp75, RIP11

Antibody data

Product number
H00026056-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026056-B01P, RRID:AB_1579465
Product name
RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026056-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RAB11FIP5 protein.
Antigen sequence
MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKS
SGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWR
EECSFELPPGALDGLLRAQEADAGPAPWAASSAAA
CELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRA
QHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSA
MFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAI
LPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLT
QSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSR
SSWLSTEGGRDSAQSPKLFTHKRTYSDEANQMRVA
PPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGP
VRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDT
WPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHPG
EEEGARLPEGKPVQVATPIVASSEAVAEKEGARKE
ERKPRMGLFHHHHQGLSRSELGRRSSLGEKGGPIL
GASPHHSSSGEGKAKSSWFGLREAKDPTQKPSPHP
VKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKT
VTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAK
YYNLTHDELISLLLQRERELSQRDEHVQELESYID
RLLVRIMETSPTLLQIPPGPPK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -