Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003146-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003146-M02, RRID:AB_437038
- Product name
- HMGB1 monoclonal antibody (M02), clone 1D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HMGB1.
- Antigen sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDAS
VNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLF
CSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGV
VKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE
DDDDE- Isotype
- IgG
- Antibody clone number
- 1D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HMGB1 secretion during cervical carcinogenesis promotes the acquisition of a tolerogenic functionality by plasmacytoid dendritic cells.
High expression of high-mobility group box 1 in the blood and lungs is associated with the development of chronic obstructive pulmonary disease in smokers.
TLR4, IL-6, IL-18, MyD88 and HMGB1 are highly expressed in intracranial inflammatory lesions and the IgG4/IgG ratio correlates with TLR4 and IL-6.
Human IgG antibody profiles differentiate between symptomatic patients with and without colorectal cancer.
Donor Toll-like receptor 4 contributes to ischemia and reperfusion injury following human kidney transplantation.
Demoulin S, Herfs M, Somja J, Roncarati P, Delvenne P, Hubert P
International journal of cancer 2015 Jul 15;137(2):345-58
International journal of cancer 2015 Jul 15;137(2):345-58
High expression of high-mobility group box 1 in the blood and lungs is associated with the development of chronic obstructive pulmonary disease in smokers.
Ko HK, Hsu WH, Hsieh CC, Lien TC, Lee TS, Kou YR
Respirology (Carlton, Vic.) 2014 Feb;19(2):253-61
Respirology (Carlton, Vic.) 2014 Feb;19(2):253-61
TLR4, IL-6, IL-18, MyD88 and HMGB1 are highly expressed in intracranial inflammatory lesions and the IgG4/IgG ratio correlates with TLR4 and IL-6.
Hirano H, Yoshioka T, Yunoue S, Fujio S, Yonezawa H, Niiro T, Habu M, Oyoshi T, Sugata S, Kamezawa T, Arimura H, Hanaya R, Tokimura H, Tokudome M, Arita K
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Dec;32(6):628-37
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Dec;32(6):628-37
Human IgG antibody profiles differentiate between symptomatic patients with and without colorectal cancer.
Kijanka G, Hector S, Kay EW, Murray F, Cummins R, Murphy D, MacCraith BD, Prehn JH, Kenny D
Gut 2010 Jan;59(1):69-78
Gut 2010 Jan;59(1):69-78
Donor Toll-like receptor 4 contributes to ischemia and reperfusion injury following human kidney transplantation.
Krüger B, Krick S, Dhillon N, Lerner SM, Ames S, Bromberg JS, Lin M, Walsh L, Vella J, Fischereder M, Krämer BK, Colvin RB, Heeger PS, Murphy BT, Schröppel B
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 3;106(9):3390-5
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 3;106(9):3390-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HMGB1 monoclonal antibody (M02), clone 1D5 Western Blot analysis of HMGB1 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M02), clone 1D5.Lane 1: HMGB1 transfected lysate(24.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
