Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003146-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003146-M03, RRID:AB_606391
- Product name
- HMGB1 monoclonal antibody (M03), clone 1B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HMGB1.
- Antigen sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDAS
VNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLF
CSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGV
VKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE
DDDDE- Isotype
- IgG
- Antibody clone number
- 1B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Anti-inflammatory effects of hyperoside in human endothelial cells and in mice.
Proteomic analysis of human epithelial lining fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Ku SK, Zhou W, Lee W, Han MS, Na M, Bae JS
Inflammation 2015 Apr;38(2):784-99
Inflammation 2015 Apr;38(2):784-99
Proteomic analysis of human epithelial lining fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Franciosi L, Govorukhina N, Fusetti F, Poolman B, Lodewijk ME, Timens W, Postma D, ten Hacken N, Bischoff R
Electrophoresis 2013 Sep;34(18):2683-94
Electrophoresis 2013 Sep;34(18):2683-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M03), clone 1B11.Lane 1: HMGB1 transfected lysate(25 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HMGB1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol