ABIN501641

HMGB1 antibody from antibodies-online
DKFZp686A04236, HMG1, HMG3, SBP-1

Antibody data

Product number
ABIN501641
Provider
antibodies-online
Product name
anti-High-Mobility Group Box 1 (HMGB1) antibody
Provider product page
antibodies-online - ABIN501641
Antibody type
Polyclonal
Antigen
The immunogen for anti-HMGB1 antibody: synthetic peptide directed towards the N terminal of human HMGB1
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
Host
Rabbit
Antigen sequence
GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASV
NFSEF SKKCSERWKT
Vial size
50 µg
Provider Type Product Number
- No reagents -