H00055510-B01P

DDX43 antibody from Abnova Corporation
CT13, DKFZp434H2114, HAGE

Antibody data

Product number
H00055510-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055510-B01P, RRID:AB_1573292
Product name
DDX43 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055510-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DDX43 protein.
Antigen sequence
MSHHGGAPKASTWVVASRRSSTVSRAPERRPAEEL
NRTGPEGYSVGRGGRWRGTSRPPEDVAAGHEELPL
CFALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQ
EQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYN
SECGIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQ
IREEGLKWQKTKWADLPPIKKNFYKESTATSAMSK
VEADSWRKENFNITWDDLKDGEKRPIPNPTCTFDD
AFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGI
DLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRN
RPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVY
GGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFV
NLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPD
RQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDL
VAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKV
IVFVSRKAVADHLSSDLILGNISVESLHGDREQRD
REKALENFKTGKVRILIATDLASRGLDVHDVTHVY
NFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRND
WRVASELINILERANQSIPEELVSMAERFKAHQQK
REMERKMERPQGRPKKFH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -