Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310830 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Reticulon 2 (RTN2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RTN2 antibody: synthetic peptide directed towards the N terminal of human RTN2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFR
ELHTA REFSEEDEEE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A reticular rhapsody: phylogenic evolution and nomenclature of the RTN/Nogo gene family.
Oertle T, Klinger M, Stuermer CA, Schwab ME
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2003 Jul;17(10):1238-47
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2003 Jul;17(10):1238-47
No comments: Submit comment
No validations: Submit validation data