Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182776 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Snail Homolog 1 (Drosophila) (SNAI1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAI1 antibody: synthetic peptide directed towards the N terminal of human SNAI1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPY
DQAHL LAAIPPPEIL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Breast cancer biological subtypes and protein expression predict for the preferential distant metastasis sites: a nationwide cohort study.
Proteomic characterization of non-small cell lung cancer in a comprehensive translational thoracic oncology database.
PRL-3 down-regulates PTEN expression and signals through PI3K to promote epithelial-mesenchymal transition.
Dual regulation of Snail by GSK-3beta-mediated phosphorylation in control of epithelial-mesenchymal transition.
Sihto H, Lundin J, Lundin M, Lehtimäki T, Ristimäki A, Holli K, Sailas L, Kataja V, Turpeenniemi-Hujanen T, Isola J, Heikkilä P, Joensuu H
Breast cancer research : BCR 2011 Sep 13;13(5):R87
Breast cancer research : BCR 2011 Sep 13;13(5):R87
Proteomic characterization of non-small cell lung cancer in a comprehensive translational thoracic oncology database.
Surati M, Robinson M, Nandi S, Faoro L, Demchuk C, Rolle CE, Kanteti R, Ferguson BD, Hasina R, Gangadhar TC, Salama AK, Arif Q, Kirchner C, Mendonca E, Campbell N, Limvorasak S, Villaflor V, Hensing TA, Krausz T, Vokes EE, Husain AN, Ferguson MK, Karrison TG, Salgia R
Journal of clinical bioinformatics 2011 Feb 28;1(8):1-11
Journal of clinical bioinformatics 2011 Feb 28;1(8):1-11
PRL-3 down-regulates PTEN expression and signals through PI3K to promote epithelial-mesenchymal transition.
Wang H, Quah SY, Dong JM, Manser E, Tang JP, Zeng Q
Cancer research 2007 Apr 1;67(7):2922-6
Cancer research 2007 Apr 1;67(7):2922-6
Dual regulation of Snail by GSK-3beta-mediated phosphorylation in control of epithelial-mesenchymal transition.
Zhou BP, Deng J, Xia W, Xu J, Li YM, Gunduz M, Hung MC
Nature cell biology 2004 Oct;6(10):931-40
Nature cell biology 2004 Oct;6(10):931-40
No comments: Submit comment
No validations: Submit validation data