Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00283455-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00283455-M08, RRID:AB_509404
- Product name
- KSR2 monoclonal antibody (M08), clone 1G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KSR2.
- Antigen sequence
PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHY
YKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPI
LEGNPLLQIEVEPTSENEEV- Isotype
- IgG
- Antibody clone number
- 1G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Kinase suppressor of Ras 2 (KSR2) regulates tumor cell transformation via AMPK.
KSR2 is an essential regulator of AMP kinase, energy expenditure, and insulin sensitivity.
Fernandez MR, Henry MD, Lewis RE
Molecular and cellular biology 2012 Sep;32(18):3718-31
Molecular and cellular biology 2012 Sep;32(18):3718-31
KSR2 is an essential regulator of AMP kinase, energy expenditure, and insulin sensitivity.
Costanzo-Garvey DL, Pfluger PT, Dougherty MK, Stock JL, Boehm M, Chaika O, Fernandez MR, Fisher K, Kortum RL, Hong EG, Jun JY, Ko HJ, Schreiner A, Volle DJ, Treece T, Swift AL, Winer M, Chen D, Wu M, Leon LR, Shaw AS, McNeish J, Kim JK, Morrison DK, Tschöp MH, Lewis RE
Cell metabolism 2009 Nov;10(5):366-78
Cell metabolism 2009 Nov;10(5):366-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of KSR2 expression in transfected 293T cell line by KSR2 monoclonal antibody (M08), clone 1G4.Lane 1: KSR2 transfected lysate (Predicted MW: 93.6 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KSR2 monoclonal antibody (M08), clone 1G4. Western Blot analysis of KSR2 expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KSR2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol