Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183134 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Voltage-Dependent Anion Channel 1 (VDAC1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-VDAC1 antibody: synthetic peptide directed towards the C terminal of human VDAC1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
- Host
- Rabbit
- Antigen sequence
SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNV
NAGGH KLGLGLEFQA- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes.
Mitochondrial metabolism in Parkinson's disease impairs quality control autophagy by hampering microtubule-dependent traffic.
Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins.
Essential role of the voltage-dependent anion channel (VDAC) in mitochondrial permeability transition pore opening and cytochrome c release induced by arsenic trioxide.
Rousset F, Nguyen MV, Grange L, Morel F, Lardy B
PloS one 2013;8(6):e66478
PloS one 2013;8(6):e66478
Mitochondrial metabolism in Parkinson's disease impairs quality control autophagy by hampering microtubule-dependent traffic.
Arduíno DM, Esteves AR, Cortes L, Silva DF, Patel B, Grazina M, Swerdlow RH, Oliveira CR, Cardoso SM
Human molecular genetics 2012 Nov 1;21(21):4680-702
Human molecular genetics 2012 Nov 1;21(21):4680-702
Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins.
Chen S, Martin C, Maya-Mendoza A, Tang CW, Lovrić J, Sims PF, Jackson DA
Journal of proteome research 2009 Nov;8(11):5196-211
Journal of proteome research 2009 Nov;8(11):5196-211
Essential role of the voltage-dependent anion channel (VDAC) in mitochondrial permeability transition pore opening and cytochrome c release induced by arsenic trioxide.
Zheng Y, Shi Y, Tian C, Jiang C, Jin H, Chen J, Almasan A, Tang H, Chen Q
Oncogene 2004 Feb 12;23(6):1239-47
Oncogene 2004 Feb 12;23(6):1239-47
No comments: Submit comment
No validations: Submit validation data