Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005172-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005172-A01, RRID:AB_462461
- Product name
- SLC26A4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SLC26A4.
- Antigen sequence
RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGF
FDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSIL
ETITLIQDCKD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel role for pendrin in orchestrating bicarbonate secretion in cystic fibrosis transmembrane conductance regulator (CFTR)-expressing airway serous cells.
Developmental expression of solute carrier family 26A member 4 (SLC26A4/pendrin) during amelogenesis in developing rodent teeth.
Garnett JP, Hickman E, Burrows R, Hegyi P, Tiszlavicz L, Cuthbert AW, Fong P, Gray MA
The Journal of biological chemistry 2011 Nov 25;286(47):41069-82
The Journal of biological chemistry 2011 Nov 25;286(47):41069-82
Developmental expression of solute carrier family 26A member 4 (SLC26A4/pendrin) during amelogenesis in developing rodent teeth.
Bronckers AL, Guo J, Zandieh-Doulabi B, Bervoets TJ, Lyaruu DM, Li X, Wangemann P, DenBesten P
European journal of oral sciences 2011 Dec;119 Suppl 1:185-92
European journal of oral sciences 2011 Dec;119 Suppl 1:185-92
No comments: Submit comment
No validations: Submit validation data