SAB1400056

CSH2 antibody from Sigma-Aldrich
CS-2, CSB, hCS-B
ELISA
Recommended by provider

Antibody data

Product number
SAB1400056
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400056, RRID:AB_1847271
Product name
Anti-CSH2 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400056
Antibody type
Polyclonal
Antigen
CSH2 (AAH22044, a.a. 1-218) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRL
FDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF
LHDSQTSFCFSDSIPTPSNVEETQQKSNLELLRIS
LLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTN
SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS
VEGSCGF* (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -