HPA019887

PCNT antibody from Atlas Antibodies
KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019887
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019887, RRID:AB_1855080
Product name
Anti-PCNT
Provider product page
Atlas Antibodies - HPA019887
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALS
LCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAAL
ALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQ
ETLSSPPPGLEGKADRSEKSDGSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -