PAB21254

PCNT antibody from Abnova Corporation
KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4

Antibody data

Product number
PAB21254
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21254, RRID:AB_10963639
Product name
PCNT polyclonal antibody
Provider product page
Abnova Corporation - PAB21254
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PCNT.
Antigen sequence
MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALS
LCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAAL
ALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQ
ETLSSPPPGLEGKADRSEKSDGSG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -