Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21254 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21254, RRID:AB_10963639
- Product name
- PCNT polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PCNT.
- Antigen sequence
- MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALS
 LCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAAL
 ALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQ
 ETLSSPPPGLEGKADRSEKSDGSG
- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with PCNT polyclonal antibody (Cat # PAB21254) at 1-4 ug/mL dilution shows positivity in centrosome.
- Validation comment
- Immunofluorescence
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunohistochemical staining of human cerebellum with PCNT polyclonal antibody (Cat # PAB21254) shows strong cytoplasmmic positivity in Purkinje cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)