HPA019887

PCNT antibody from Sigma-Aldrich
KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019887, RRID:AB_1855080
Product name
Anti-PCNT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019887
Antibody type
Polyclonal
Antigen
Pericentrin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALS
LCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAAL
ALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQ
ETLSSPPPGLEGKADRSEKSDGSG
Storage
-20C
Provider Type Product Number
- No reagents -