Explore
Validate
LearnH00009221-M01
antibody from Abnova Corporation
Targeting: NOLC1
KIAA0035, NOPP130, NOPP140, P130, Srp40
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009221-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009221-M01, RRID:AB_1112294
- Product name
- NOLC1 monoclonal antibody (M01), clone 3F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NOLC1.
- Antigen sequence
EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSP
FRRVREEEIEVDSRVADNSFDAKRGAAGDWGERAN
QVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSI
KFDSE- Isotype
- IgG
- Antibody clone number
- 3F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NOLC1 monoclonal antibody (M01), clone 3F8. Western Blot analysis of NOLC1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NOLC1 expression in transfected 293T cell line by NOLC1 monoclonal antibody (M01), clone 3F8.Lane 1: NOLC1 transfected lysate (Predicted MW: 73.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NOLC1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
