Antibody data

Product number
H00004515-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004515-M05, RRID:AB_1136963
Product name
MTCP1 monoclonal antibody (M05), clone 1G12
Provider product page
Abnova Corporation - H00004515-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MTCP1.
Antigen sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQEL
RKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Isotype
IgG
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -