HPA003083

THAP7 antibody from Atlas Antibodies
MGC10963
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003083
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003083, RRID:AB_1080264
Product name
Anti-THAP7
Provider product page
Atlas Antibodies - HPA003083
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDP
ASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPT
IFESFSKLRRTTKTKGHSYPPGPPEVSRLRRCRKR
CSEGRGPTTPFSPPPPADVTCFP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -