HPA023652

RNF19A antibody from Atlas Antibodies
DKFZp566B1346, dorfin, RNF19
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023652, RRID:AB_1847836
Product name
Anti-RNF19A
Provider product page
Atlas Antibodies - HPA023652
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPL
CLLRHSKDRFPDIMTCHHRSCVDCL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -