HPA023652

RNF19A antibody from Sigma-Aldrich
DKFZp566B1346, dorfin, RNF19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023652, RRID:AB_1847836
Product name
Anti-RNF19A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023652
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RNF19A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPL
CLLRHSKDRFPDIMTCHHRSCVDCL
Storage
-20C
Provider Type Product Number
- No reagents -