H00001716-M04

DGUOK antibody from Abnova Corporation
dGK
No application information provided.

Antibody data

Product number
H00001716-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001716-M04, RRID:AB_1204267
Product name
DGUOK monoclonal antibody (M04), clone 4E5
Provider product page
Abnova Corporation - H00001716-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DGUOK.
Antigen sequence
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAG
RGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATE
PVATWQNIQAAGTQKACTAQSLGNLLDMMYREPAR
WSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIF
ERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSF
LLWEFASRITLHGFIYLQASPQVCLKRLYQRAREE
EKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNI
PVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL
Isotype
IgG
Antibody clone number
4E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -