HPA026808

PRRX2 antibody from Sigma-Aldrich
PMX2, PRX2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026808
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026808, RRID:AB_10603228
Product name
Anti-PRRX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026808
Antibody type
Polyclonal
Antigen
paired related homeobox 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAP
RPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPG
VNMANSIASLRLKAKEFSLHHSQVPTVN
Storage
-20C
Provider Type Product Number
- No reagents -