H00006845-A01

VAMP7 antibody from Abnova Corporation
SYBL1, TI-VAMP, VAMP-7
No application information provided.

Antibody data

Product number
H00006845-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006845-A01, RRID:AB_1581826
Product name
VAMP7 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006845-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant VAMP7.
Antigen sequence
AWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFH
YICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQT
TYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGL
DKVME
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -