HPA030850

CACNA2D3 antibody from MilliporeSigma / Merck KGaA
HSA272268
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030850
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CACNA2D3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030850
Antibody type
Polyclonal
Antigen
calcium channel, voltage-dependent, alpha 2/delta subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIE
GAVMNKLLTMGSFKRITLYDYQAMCRANKESSDG
Storage
-20C