Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007474-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007474-M04, RRID:AB_1717123
- Product name
- WNT5A monoclonal antibody (M04), clone 3A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WNT5A.
- Antigen sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLAD
VACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKY
DSAAAMRLNSRGKLVQVNSRFNSPTTQDLV- Isotype
- IgG
- Antibody clone number
- 3A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references WNT5A has anti-prostate cancer effects in vitro and reduces tumor growth in the skeleton in vivo.
Thiele S, Göbel A, Rachner TD, Fuessel S, Froehner M, Muders MH, Baretton GB, Bernhardt R, Jakob F, Glüer CC, Bornhäuser M, Rauner M, Hofbauer LC
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2015 Mar;30(3):471-80
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2015 Mar;30(3):471-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged WNT5A is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol