Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040967 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040967, RRID:AB_10794430
- Product name
- Anti-DNAJB9
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSG
FDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTT
YTDCSGQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Monoclonal Gammopathy of Renal Significance: Histomorphological Spectrum at a Tertiary Care Center
DNAJB9 Is a Specific Immunohistochemical Marker for Fibrillary Glomerulonephritis
DnaJ Heat Shock Protein Family B Member 9 Is a Novel Biomarker for Fibrillary GN
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Barwad A, Bajaj V, Singh G, Dinda A, Sahoo R, Kumar L, Agarwal S
Glomerular Diseases 2022;2(4):153-163
Glomerular Diseases 2022;2(4):153-163
DNAJB9 Is a Specific Immunohistochemical Marker for Fibrillary Glomerulonephritis
Nasr S, Vrana J, Dasari S, Bridoux F, Fidler M, Kaaki S, Quellard N, Rinsant A, Goujon J, Sethi S, Fervenza F, Cornell L, Said S, McPhail E, Herrera Hernandez L, Grande J, Hogan M, Lieske J, Leung N, Kurtin P, Alexander M
Kidney International Reports 2018;3(1):56-64
Kidney International Reports 2018;3(1):56-64
DnaJ Heat Shock Protein Family B Member 9 Is a Novel Biomarker for Fibrillary GN
Dasari S, Alexander M, Vrana J, Theis J, Mills J, Negron V, Sethi S, Dispenzieri A, Highsmith W, Nasr S, Kurtin P
Journal of the American Society of Nephrology 2018;29(1):51-56
Journal of the American Society of Nephrology 2018;29(1):51-56
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
No comments: Submit comment
No validations: Submit validation data